1. Recombinant Proteins
  2. CD Antigens Enzymes & Regulators
  3. Endothelial cell CD Proteins Hydrolases (EC 3)
  4. BST1/CD157
  5. CD157 Protein, Rat (HEK293, His)

CD157 protein catalyzes the synthesis of cADPR from NAD(+) and hydrolyzes cADPR to ADPR. cADPR acts as a second messenger, releasing calcium from intracellular stores. CD157 protein may also contribute to pre-B cell growth. CD157 Protein, Rat (HEK293, His) is the recombinant rat-derived CD157 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 45 In-stock
10 μg USD 75 In-stock
50 μg USD 190 In-stock
100 μg USD 300 In-stock
> 100 μg   Get quote  

Get it by tomorrow April 16 for select sizes. Order within 4 hrs 36 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD157 protein catalyzes the synthesis of cADPR from NAD(+) and hydrolyzes cADPR to ADPR. cADPR acts as a second messenger, releasing calcium from intracellular stores. CD157 protein may also contribute to pre-B cell growth. CD157 Protein, Rat (HEK293, His) is the recombinant rat-derived CD157 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD157 protein acts as an enzyme that catalyzes the synthesis of cyclic ADP-beta-D-ribose (cADPR) from NAD(+) and also hydrolyzes cADPR to ADP-D-ribose (ADPR). Cyclic ADPR functions as a natural second messenger, triggering the release of calcium from intracellular stores and thereby controlling the mobilization of intracellular calcium. Additionally, CD157 protein may play a role in the growth of pre-B cells.

Biological Activity

Measured by its binding ability in a functional ELISA. When Fibronectin is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Rat CD157 Protein. The ED50 for this effect is 4.274 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Fibronectin is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Rat CD157 Protein. The ED50 for this effect is 4.274 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q63072 (R34-E293)

Gene ID
Molecular Construction
N-term
CD157 (R34-E293)
Accession # Q63072
His
C-term
Synonyms
ADP-ribosyl cyclase; BST1; Cyclic ADP-ribose hydrolase 2; CD157
AA Sequence

RWSGEGTTPHLQSIFLGRCAEYTTLLSLEPGNKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHAIPRDKSLFWENNHLLVMSYAENTRRLMPLCDVLYGKVGDFLSWCRQENASGLDYQSCPTAEDCENNAVDAYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTKGFFADFEIPYLQKDKITRIEIWVMHEVGGPHVESCGEGSVKILEDRLEALGFQHSCINDYPPVKFLMCVDHSTHPDCAMNSASASMWRE

Molecular Weight

Approximately 33-45 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD157 Protein, Rat (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD157 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76205
Quantity:
MCE Japan Authorized Agent: