CD164 Protein, Cynomolgus (HEK293, Fc)

CD164 Protein, a sialomucin, potentially plays a pivotal role in hematopoiesis, facilitating CD34⁺ cell adhesion while negatively regulating CD34⁺ cell proliferation^[1]. CD164 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD164 Protein, Cynomolgus (HEK293, Fc) is 163 a.a., with molecular weight of 75-110 KDa.

CD164 Protein belongs to the mucin or sialomucin family of glycoproteins. It modulates umbilical cord blood CD133⁺ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow infiltration. CD164 enhances CXCR4-dependent cell motility, myoblast migration, and myoblast fusion into myotubes, exerting positive influences on myogenesis. The protein, existing as a homodimer (isoform 4), interacts with CXCR4 in these processes. Human CD164 is a type 1 integral transmembrane molecule containing in its extracellular region two highly 0-glycosylated domains linked by a cysteine-rich non-mucin subdomain^[1].

When Recombinant Cynomolgus CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED₅₀ for this effect is 3.053 μg/mL.

• 
  When Recombinant Cynomolgus CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED₅₀ for this effect is 3.053 μg/mL.

Cynomolgus

HEK293

C-hFc

XP_005551610 (N26-D163)

102136974  [NCBI]

NPTPHTNVTSLAPTSNITSAPVTSLPLVTTPAPETCEGRNSCVSCFNASTVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVVPTATLVPTANSTAKPTVQPSPSTTSKTVTTSGTTNTTVTPTSQPVRKSTFD

Approximately 75-110 kDa to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.