CD2 Protein, Mouse (HEK293, His)

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD2 Protein, Mouse (HEK293, His) is 181 a.a., with molecular weight of approximately 33.79 kDa.

CD2, a cell surface glycoprotein, is involved in identical protein binding activity and plays a crucial role in various immune processes. Predicted to participate in T cell activation, heterotypic cell-cell adhesion, and positive regulation of cytokine production, CD2 is primarily located in cellular components such as cell-cell junctions and the external side of the plasma membrane. As an anchored component of the plasma membrane, CD2 exhibits biased expression in tissues related to the immune system, including the thymus and spleen, with notable expression levels, such as RPKM 30.1 and RPKM 18.0, respectively, indicating its significance in immune function and regulation.

Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED₅₀ for this effect is 383.6 ng/ml, corresponding to a specific activity is 2.607×10^3 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED₅₀ for this effect is 383.6 ng/mL, corresponding to a specific activity is 2.607×10³ units/mg.

Mouse

HEK293

C-10*His

NP_038514.1 (R23-S203)

12481  [NCBI]

RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

approximately 33.79 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.