1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD200
  5. CD200 Protein, Human (HEK293, His)

CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, His) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, His) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD200 Protein acts as a potent costimulator for T-cell proliferation and is implicated in regulating myeloid cell activity across various tissues. Its functional interplay with CD200R1 is facilitated through the interaction of their N-terminal Ig-like domains, suggesting a pivotal role in modulating immune responses and maintaining homeostasis within diverse cellular environments.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P41217-1 (Q31-G232)

Gene ID
Molecular Construction
N-term
CD200 (Q31-G232)
Accession # P41217-1
6*His
C-term
Synonyms
OX-2 Membrane Glycoprotein; CD200; MOX1; MOX2
AA Sequence

QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

Molecular Weight

35-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD200 Protein, Human (HEK293, His)
Cat. No.:
HY-P70476
Quantity:
MCE Japan Authorized Agent: