CD200R1 Protein, Human (HEK293, His)

The CD200R1 protein is an inhibitory receptor that regulates key interactions by binding to the CD200/OX2 glycoprotein to limit inflammation by inhibiting TNF-α, interferon, and iNOS. Interestingly, CD200R1 displays comparable affinity and kinetics to the human herpesvirus 8 K14 viral CD200 homologue, reflecting its host CD200 interaction. CD200R1 Protein, Human (HEK293, His) is the recombinant human-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

CD200R1, an inhibitory receptor, acts as a pivotal modulator by binding to the CD200/OX2 cell surface glycoprotein. Its regulatory role extends to limiting inflammation through the suppression of pro-inflammatory molecules, including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS), in response to specific stimuli. Intriguingly, CD200R1 exhibits comparable affinity and kinetics when binding to the Human herpesvirus 8 K14 viral CD200 homolog, mirroring its interaction with the host CD200. The interaction between CD200 and CD200R1 is facilitated through their respective N-terminal Ig-like domains, emphasizing the significance of this molecular interplay. Moreover, CD200R1 engages with the Human herpesvirus 8 vOX2 protein, further expanding its versatile interactions in cellular processes.

Human

HEK293

C-6*His

Q8TD46-4 (A27-L266)

131450  [NCBI]

AAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYRKETNETKETNCTDERITWVSRPDQNSDLQIRPVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAQISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL

50-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.