1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins
  4. TNF Receptor Superfamily CD27
  5. CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc)

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Background

The CD27/NFRSF7 Protein serves as a receptor for CD70/CD27L and is implicated in the survival of activated T-cells. Additionally, it may play a role in apoptosis by interacting with SIVA1. The protein forms homodimers and engages with SIVA1 and TRAF2, suggesting its involvement in diverse cellular processes.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-6*His

Accession

P41272 (P24-R182)

Gene ID
Molecular Construction
N-term
CD27 (P24-R182)
Accession # P41272
hFc-6*His
C-term
Synonyms
CD27 antigen; CD27; T-cell activation antigen CD27; T14; TNFRSF7
AA Sequence

PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

Molecular Weight

60-66 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P72743
Quantity:
MCE Japan Authorized Agent: