CD30 Ligand/TNFSF8 Protein, Rat (HEK293, Fc)

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching^[1]. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system^[2]. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division^[3]. As for CD30 ligand in rat contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Rat (HEK293, Fc) is 172 amino acids in length (Q66-D237) and is expressed in the HEK293 cells with a N-terminal hFc-tag.

CD30 Ligand (CD30L) is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching^[1].
CD30L is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family, structurally related to tumour necrosis superfamily members TNF alpha, TNF beta, and CD40^[1][3].
CD30L enhances cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines to play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. CD30L also enhances release of cytokine IL-6, TNF, LT-a^[2].
CD30L exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division regulation^[3].
CD30L is mainly expressed on activated T cells, B cells, macrophages and DCs, while CD30/CD30L mainly expressed on the surface of activated CD4+ T cells in the lamina propria (LP), especially at the early stage of Th17 cell differentiation. CD30L deficiency could inhibit Th17 cell differentiation and production of IL-17A in the intestinal mucosa^[4].
CD30L acts as a pro-inflammatory cytokines, is involved in the adaptive immune response in ulcerative colitis (UC), the level of which shows positive correlation with the severity of UC^[5].

Immobilized rat S4-Fc3L3-TNFSF8 at 10 μg/mL (100 μl/well) can bind biotinylated human CD30-Fch , The EC₅₀ of biotinylated human CD30-Fch is 8.3-19.3 ng/mL.

Rat

HEK293

N-hFc

M0R3V3 (Q66-D237)

683163  [NCBI]

QKKDSTPKTTESVPLKGGNCSEDLLCTLKRTPSKKSWAYLQVSKHLNSAKLSWNQDGTIHGLVYQDGNLVVQFPGWYFIICQLQFLVQCSNHSMDLTLQLVINSKIKKQALVTVCESGVQGKNIYHNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

Approximately 58 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Cerutti A, et al. CD30 is a CD40-inducible molecule that negatively regulates CD40-mediated immunoglobulin class switching in non-antigen-selected human B cells. Immunity. 1998 Aug;9(2):247-56.  [Content Brief]

  [2]. Gruss H-J, et al. CD30 ligand, a member of the TNF ligand superfamily, with growth and activation control CD30+ lymphoid and lymphoma cells. Leuk Lymphoma. 1996 Feb;20(5-6):397-409.  [Content Brief]

  [3]. Pera MF, et al. CD30 and its ligand: possible role in regulation of teratoma stem cells. APMIS. 1998 Jan;106(1):169-72; discussion 173.  [Content Brief]

  [4]. Wang X, et al. CD30L/CD30 signaling regulates the formation of the tumor immune microenvironment and inhibits intestinal tumor development of colitis-associated colon cancer in mice. Int Immunopharmacol. 2020 Jul;84:106531.  [Content Brief]

  [5]. Mei C, et al. CD30L+ classical monocytes play a pro-inflammatory role in the development of ulcerative colitis in patients. Mol Immunol. 2021 Oct;138:10-19.  [Content Brief]