CD300e Protein, Human (HEK293, Fc)

The CD300e protein may be an activating receptor, suggesting involvement in cell signaling and immune responses. CD300e interacts with TYROBP to regulate cellular activities and coordinate immune responses. CD300e Protein, Human (HEK293, Fc) is the recombinant human-derived CD300e protein, expressed by HEK293 , with C-hFc labeled tag.

The CD300e protein is likely an activating receptor, suggesting its involvement in cellular signaling and immune responses. Through interactions with TYROBP, CD300e may play a role in modulating cellular activities and coordinating immune responses. Elucidating the specific ligands and downstream signaling pathways influenced by CD300e will provide a deeper understanding of its functional significance in immune regulation. Further investigations into the molecular interactions and cellular contexts involving CD300e and its association with TYROBP will contribute valuable insights into its role as an activating receptor in immune processes.

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED₅₀ for this effect is 1.707 μg/mL. Corresponding to a specific activity is 585.823 U/mg.

• 
  Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED₅₀ for this effect is 1.707 μg/mL. Corresponding to a specific activity is 585.823 U/mg.

Human

HEK293

C-hFc

Q496F6 (L18-H173)

342510  [NCBI]

LKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPH

Approximately 55-57 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.