CD300LB Protein, Human (HEK293, hFc)

CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (HEK293, hFc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag.

CD300LB protein functions as an activating immune receptor, engaging in its immune-modulatory role through interaction with the ITAM-bearing adapter TYROBP and independently by recruiting GRB2. Its interaction with TYROBP not only enhances cell surface expression but also boosts activation properties. In the presence of FYN, CD300LB further interacts with GRB2, revealing a multifaceted mechanism through which this protein contributes to immune signaling pathways.

Human

HEK293

C-hFc

AAH28091.1 (I55-H187)

124599  [NCBI]

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH

50-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.