1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD30L/CD153 CD30L/CD153
  5. CD30L/CD153
  6. CD30L Protein, Cynomolgus (HEK293, His)

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division. As for CD30 ligand in cynomolgus contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30L Protein, Cynomolgus (HEK293, His) is 172 amino acids in length (Q63-D234) and is expressed in the HEK293 cells with a N-terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1]. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system[2]. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division[3]. As for CD30 ligand in cynomolgus contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30L Protein, Cynomolgus (HEK293, His) is 172 amino acids in length (Q63-D234) and is expressed in the HEK293 cells with a N-terminal His-tag.

Background

CD30 Ligand (CD30L) is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1].
CD30L is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family, structurally related to tumour necrosis superfamily members TNF alpha, TNF beta, and CD40[1][3].
CD30L enhances cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines to play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. CD30L also enhances release of cytokine IL-6, TNF, LT-a[2].
CD30L exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division regulation[3].
CD30L is mainly expressed on activated T cells, B cells, macrophages and DCs, while CD30/CD30L mainly expressed on the surface of activated CD4+ T cells in the lamina propria (LP), especially at the early stage of Th17 cell differentiation. CD30L deficiency could inhibit Th17 cell differentiation and production of IL-17A in the intestinal mucosa[4].
CD30L acts as a pro-inflammatory cytokines, is involved in the adaptive immune response in ulcerative colitis (UC), the level of which shows positive correlation with the severity of UC[5].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD30L at 10 μg/mL (100 μ L/well) can bind biotinylated human CD30. The ED50 for this effect is 3.499 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD30L at 10 μg/mL (100 μL/well) can bind biotinylated human CD30. The ED50 for this effect is 3.499 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

N-His

Accession

G7P2F1 (Q63-D234)

Gene ID

/

Molecular Construction
N-term
His
CD30L (Q63-D234)
Accession # G7P2F1
C-term
Synonyms
TNF superfamily member 8; CD153; CD30 Ligand; TNFSF8
AA Sequence

QRTDSIPNSPDNIPLRGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTVSVNVDTFQYIDTSTFPLENVLSVFLYSNSD

Molecular Weight

25-43 kDa due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CD30L Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD30L Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77322
Quantity:
MCE Japan Authorized Agent: