Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His)

Cat. No.: HY-P72735: FAQs
Data Sheet
SDS

COA
Handling Instructions Technical Support

Protein solubilization and storage

Help & FAQs

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and is involved in a variety of effector and regulatory functions. When co-aggregated with BCR, TCR and Fc receptors, it promotes endocytosis of soluble immune complexes (IIB2), modulates antibody production, and downregulates B-cell, T-cell and mast cell activation. Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Price	Stock	Quantity
10 μg	USD 152	In-stock	Estimated Time of Arrival: March 24
50 μg	USD 400	In-stock	Estimated Time of Arrival: March 24
100 μg		Get quote

Get it March 24 by noon. Order within 18 hrs 2 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Biological Activity
Technical Parameters
Properties
Documentation

Description	Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and is involved in a variety of effector and regulatory functions. When co-aggregated with BCR, TCR and Fc receptors, it promotes endocytosis of soluble immune complexes (IIB2), modulates antibody production, and downregulates B-cell, T-cell and mast cell activation. Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.
Background	Fc gamma RIIB/CD32b Protein functions as a receptor for the Fc region of complexed immunoglobulins gamma, exhibiting low affinity. It plays a role in various effector and regulatory functions, including the phagocytosis of antigen-antibody complexes from the circulation and the modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but do not mediate endocytosis or phagocytosis, while isoform IIB2 can facilitate the endocytosis of soluble immune complexes via clathrin-coated pits. Both isoform IIB1 and isoform IIB2 can down-regulate the activation of B-cells, T-cells, and mast cells when coaggregated with B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively. Fc gamma RIIB/CD32b interacts with FGR and LYN (By similarity).
Species	Mouse
Source	HEK293
Tag	C-6*His
Accession	P08101 (T30-P210)
Gene ID	14130 [NCBI]
Molecular Construction	N-term Fc gamma RIIB/CD32b (T30-P210) Accession # P08101 6*His C-term
Synonyms	Low affinity immunoglobulin gamma Fc region receptor II; Fc-gamma-RIIB; Ly-17; CD32; Fcgr2
AA Sequence	THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP
Molecular Weight	Approximately 31 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (236 KB) SDS (251 KB) COA (205 KB) Handling Instructions (2659 KB)

Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?
1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.
How should solution-form recombinant proteins be stored?
1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that
Why is it necessary to add carrier proteins?
Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.
Carrier protein types and options?
In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

Reconstitution Calculator
Dilution Calculator
Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)	=	Mass (in vial)	÷	Desired Reconstitution Concentration
	=		÷

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Specific Activity (Unit/mg)	=	10⁶	÷	Biological Activity (ED₅₀)
Unit/mg	=	10⁶	÷	ng/mL

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Country or Region *

Email Address *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His)

Biological Activity

Technical Parameters

Properties

Documentation

Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) Related Classifications

Reconstitution Calculator

Dilution Calculator

Specific Activity Calculator

The reconstitution calculator equation

The dilution calculator equation

The specific activity calculator equation

Your Recently Viewed Products:

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report