Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His)

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and is involved in a variety of effector and regulatory functions. When co-aggregated with BCR, TCR and Fc receptors, it promotes endocytosis of soluble immune complexes (IIB2), modulates antibody production, and downregulates B-cell, T-cell and mast cell activation. Fc gamma RIIB/CD32b Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.

Fc gamma RIIB/CD32b Protein functions as a receptor for the Fc region of complexed immunoglobulins gamma, exhibiting low affinity. It plays a role in various effector and regulatory functions, including the phagocytosis of antigen-antibody complexes from the circulation and the modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but do not mediate endocytosis or phagocytosis, while isoform IIB2 can facilitate the endocytosis of soluble immune complexes via clathrin-coated pits. Both isoform IIB1 and isoform IIB2 can down-regulate the activation of B-cells, T-cells, and mast cells when coaggregated with B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively. Fc gamma RIIB/CD32b interacts with FGR and LYN (By similarity).

Mouse

HEK293

C-6*His

P08101 (T30-P210)

14130  [NCBI]

THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP

Approximately 31 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.