1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Stem Cell CD Proteins
  4. CD38
  5. CD38 Protein, Rat (HEK293, His)

CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, His) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, His) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CD38 protein performs multiple essential functions. It is responsible for synthesizing two crucial second messengers, cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate. Cyclic ADP-ribose acts as a second messenger for glucose-induced insulin secretion, while nicotinate-adenine dinucleotide phosphate functions as a calcium mobilizer. CD38 also possesses cADPR hydrolase activity, adding to its functional repertoire. Additionally, CD38 regulates osteoclastic bone resorption, most likely through the production of cyclic ADP-ribose and the initiation of a calcium ion signal via activation of the ryanodine receptor.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q64244 (W45-V303)

Gene ID
Molecular Construction
N-term
CD38 (W45-V303)
Accession # Q64244
6*His
C-term
Synonyms
rRtADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1, His ; 17-1A; 323/A3; ACSTD1; CD326; EGP-2; EGP314; EGP40; EpCAM; MOC31; TACST-1; TACSTD1; TROP1;
AA Sequence

WPRSPLVWKGKPTTKHFADIILGRCLIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSEPFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSCRLNV

Molecular Weight

35-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD38 Protein, Rat (HEK293, His)
Cat. No.:
HY-P70077
Quantity:
MCE Japan Authorized Agent: