CD44 Protein, Mouse (HEK293, His)

The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD44 Protein, Mouse (HEK293, His) is 200 a.a., with molecular weight of ~37 kDa.

CD44 Protein plays a multifaceted role by enabling hyaluronic acid binding activity and type II transforming growth factor beta receptor binding activity, contributing to cytokine binding activity and cytokine receptor activity. Engaged in processes such as negative regulation of T cell activation, positive regulation of protein phosphorylation, and the regulation of intracellular signal transduction, CD44 acts upstream of or within critical processes like the Wnt signaling pathway, morphogenesis of a branching epithelium, and wound healing involved in inflammatory response. The protein is strategically located in the basolateral plasma membrane, external side of the plasma membrane, and microvillus, and it is a component of the macrophage migration inhibitory factor receptor complex. CD44 exhibits broad expression across various structures, including the alimentary system, branchial arch, central nervous system, genitourinary system, and limb. Implicated in diseases such as breast carcinoma, carcinoma, and prostate cancer, CD44 demonstrates broad expression in lung adult (RPKM 13.1), spleen adult (RPKM 8.5), and 23 other tissues, emphasizing its pivotal roles in diverse physiological processes and potential contributions to cancer pathogenesis.

Measured by its binding ability in a functional ELISA. When rmCD44 is present at 1 μg/mL, the concentration of biotinylated hyaluronan that produces 50% of the optimal binding response is found to be approximately 17.45 ng/mL.

• 
  Measured by its binding ability in a functional ELISA.When rmCD44 is present at 1 μg/mL, the concentration of biotinylated hyaluronan that produces 50% of the optimal binding response is found to be approximately 17.45 ng/mL.

Mouse

HEK293

C-His

NP_001034240.1 (Q25-T224)

12505  [NCBI]

QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Approximately 37 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.