1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD44/ECMR-III
  5. CD44 Protein, Mouse (HEK293, His)

CD44 Protein, Mouse (HEK293, His)

Cat. No.: HY-P74291
SDS COA Handling Instructions

The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD44 Protein, Mouse (HEK293, His) is 200 a.a., with molecular weight of ~37 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD44 Protein, Mouse (HEK293, His) is 200 a.a., with molecular weight of ~37 kDa.

Background

CD44 Protein plays a multifaceted role by enabling hyaluronic acid binding activity and type II transforming growth factor beta receptor binding activity, contributing to cytokine binding activity and cytokine receptor activity. Engaged in processes such as negative regulation of T cell activation, positive regulation of protein phosphorylation, and the regulation of intracellular signal transduction, CD44 acts upstream of or within critical processes like the Wnt signaling pathway, morphogenesis of a branching epithelium, and wound healing involved in inflammatory response. The protein is strategically located in the basolateral plasma membrane, external side of the plasma membrane, and microvillus, and it is a component of the macrophage migration inhibitory factor receptor complex. CD44 exhibits broad expression across various structures, including the alimentary system, branchial arch, central nervous system, genitourinary system, and limb. Implicated in diseases such as breast carcinoma, carcinoma, and prostate cancer, CD44 demonstrates broad expression in lung adult (RPKM 13.1), spleen adult (RPKM 8.5), and 23 other tissues, emphasizing its pivotal roles in diverse physiological processes and potential contributions to cancer pathogenesis.

Biological Activity

Measured by its binding ability in a functional ELISA. When rmCD44 is present at 1 μg/mL, the concentration of biotinylated hyaluronan that produces 50% of the optimal binding response is found to be approximately 17.45 ng/mL.

  • Measured by its binding ability in a functional ELISA.When rmCD44 is present at 1 μg/mL, the concentration of biotinylated hyaluronan that produces 50% of the optimal binding response is found to be approximately 17.45 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

NP_001034240.1 (Q25-T224)

Gene ID
Molecular Construction
N-term
CD44 (Q25-T224)
Accession # NP_001034240.1
His
C-term
Synonyms
CD44 antigen; CDw44; Epican; ECMR-III; CD44; LHR; MDU2
AA Sequence

QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Molecular Weight

Approximately 37 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD44 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74291
Quantity:
MCE Japan Authorized Agent: