1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TAPA-1/CD81
  5. CD81 Protein, Mouse (HEK293, His)

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Background

CD81 is a protein that plays a crucial role in various cellular processes. It is involved in the trafficking and compartmentalization of the CD19 receptor on the surface of activated B cells. This facilitates the assembly of CD19-CR2 and B cell receptor complexes, which lowers the threshold dose of antigen required to trigger B cell clonal expansion and immune response. In T cells, CD81 associates with CD4 or CD8 coreceptors and helps define the maturation state of synapses with B cells. It also facilitates the localization of CD3 in immune synapses, which is necessary for T cell activation and costimulation. CD81 can act as both a positive and negative regulator of cell-cell fusion processes. In myoblasts, it associates with CD9 and PTGFRN to inhibit myotube fusion during muscle regeneration. In macrophages, CD81 prevents fusion into multinucleated giant cells and osteoclasts. It also regulates sperm-egg fusion and may be involved in the acrosome reaction. CD81 is involved in protein trafficking within intracellular compartments and regulates intracellular dNTP levels in T cells. Additionally, it plays a role in integrin-dependent migration of macrophages and is specifically required for the infectivity of Plasmodium yoelii in hepatocytes during malaria infection.

Biological Activity

Immobilized Mouse CD81 at 1 μg/mL (100 μL/well) can bind Anti-CD81 Antibody, The ED50 for this effect is 5.548 ng/mL.

Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

P35762 (K116-K201)

Gene ID
Molecular Construction
N-term
His
CD81 (K116-K201)
Accession # P35762
C-term
Synonyms
CD81 antigen; CD81; CVID6; TAPA-1; TSPAN28
AA Sequence

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Molecular Weight

Approximately 10 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD81 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74262
Quantity:
MCE Japan Authorized Agent: