1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CD66d/CEACAM3 Immunoglobulin-like Cell Adhesion Molecules
  5. CD66d/CEACAM3
  6. CEACAM3 Protein, Human (HEK293, His)

The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CEACAM3 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of 18-20 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CEACAM3 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of 18-20 kDa.

Background

CEACAM3 Protein emerges as a pivotal granulocyte receptor that orchestrates the efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, encompassing pathogens such as Neisseria, Moraxella, and Haemophilus species. This significant role positions CEACAM3 at the forefront of pathogen clearance within the innate immune system. In the course of pathogen phagocytosis, CEACAM3 takes on the responsibility of stimulating RAC1, further contributing to the cellular processes involved in pathogen engulfment. Notably, CEACAM3 engages in a calcium-dependent interaction with S100A9/calprotectin, a dynamic interaction that occurs independently of CEACAM3 phosphorylation. This intricate network of functions underscores the multifaceted role of CEACAM3 in orchestrating effective immune responses against a spectrum of microorganisms.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P40198 (K35-G155)

Gene ID
Molecular Construction
N-term
CEACAM3 (K35-G155)
Accession # P40198
6*His
C-term
Synonyms
Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3; CD66d; CEACAM3; CGM1
AA Sequence

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

Molecular Weight

18-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CEACAM3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM3 Protein, Human (HEK293, His)
Cat. No.:
HY-P72694
Quantity:
MCE Japan Authorized Agent: