CEACAM7 Protein, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC). CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CEACAM7 Protein, Human (HEK293, His) is 107 a.a., with molecular weight of 20-30 kDa.

CEAM7/CEACAM7 are cell surface glycoproteins belonging to the carcinoembryonic antigen (CEA) protein family. Carcinoembryonic antigen (CEA) is a classic colorectal cancer tumor marker, such as CEACAM1, CEACAM5, and CEACAM6, which are considered effective clinical biomarkers and therapeutic targets for melanoma, lung, colorectal, and pancreatic cancer. CEACAM5, CEACAM6, CEACAM7, and CEACAM8 are associated with the cell membrane through GPI connections. Among them, CEACAM6 and CEACAM7 are differentially expressed in normal tissues and dysregulated in hyperplastic colorectal polyps and early adenomas. The expression of CEACAM7 may be downregulated in colon and rectal cancers or may predict rectal cancer recurrence. There is an association between higher expression of CEACAM7 and poor prognosis in patients with a high risk ratio and may serve as a potential early diagnostic and/or prognostic marker for pancreatic ductal adenocarcinoma (PDAC).

Human

HEK293

C-6*His

AAI21133.1 (T36-F142)

1087  [NCBI]

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

20-30 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.