1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. CEA Cell Adhesion Molecule 7 (CEACAM7)
  6. CEACAM7 Protein, Human (His-SUMO)

Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain. CEACAM7 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM7 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CEACAM7 Protein, Human (His-SUMO) is 207 a.a., with molecular weight of ~39.4 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain. CEACAM7 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM7 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CEACAM7 Protein, Human (His-SUMO) is 207 a.a., with molecular weight of ~39.4 kDa.

Background

Carcinoembryonic antigen-related cell adhesion molecule 7 encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Carcinoembryonic antigen-related cell adhesion molecule 7 with lower expression levels may be predictive of rectal cancer recurrence. Carcinoembryonic antigen-related cell adhesion molecule 7 is present in a CEA family gene cluster on chromosome 19[1][2][3].

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q14002 (T36-S242)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CEACAM7 (T36-S242)
Accession # Q14002
C-term
Synonyms
Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2
AA Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Molecular Weight

Approximately 39.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM7 Protein, Human (His-SUMO)
Cat. No.:
HY-P72132
Quantity:
MCE Japan Authorized Agent: