CEBP gamma/CEBPG Protein, Human (His)

CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag. The total length of CEBP gamma/CEBPG Protein, Human (His) is 109 a.a., with molecular weight of ~16 kDa.

CEBP gamma/CEBPG protein functions as a transcription factor, exerting its regulatory influence by binding to both the promoter and enhancer regions of target genes. It specifically binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene, as well as to the promoter and enhancer regions of the immunoglobulin heavy chain. Additionally, CEBP gamma/CEBPG binds to GPE1, a cis-acting element in the G-CSF gene promoter. Its DNA binding occurs as a dimer, and it has the capacity to form stable heterodimers with CEBPA and CEBPB, underscoring its versatile interaction profile. Furthermore, CEBP gamma/CEBPG interacts with ZNF638, and this interaction contributes to increased transcriptional activation, further highlighting its role in modulating gene expression.

Human

E. coli

N-His

P53567 (P39-N147)

1054  [NCBI]

PGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDN

Approximately 16 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.