CEBPA Protein, Human (His)

CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. The reference paragraph states that CEBPA protein interacts with TAF1A and UBTF. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag. The total length of CEBPA Protein, Human (His) is 358 a.a., with molecular weight of ~44 kDa.

CEBPA protein, also known as CCAAT/enhancer-binding protein alpha, is a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular differentiation, proliferation, and metabolism. CEBPA protein interacts with TAF1A and UBTF. TAF1A is a component of the general transcription factor TFIID, which is essential for the initiation of transcription. The interaction between CEBPA and TAF1A suggests a potential involvement of CEBPA in the regulation of transcriptional activity through its association with the TFIID complex. UBTF, on the other hand, is a nucleolar protein that participates in ribosomal RNA transcription and ribosome biogenesis. The interaction between CEBPA and UBTF hints at a potential role for CEBPA in the regulation of these processes. Further investigation is needed to fully understand the functional implications of these interactions and their contribution to cellular processes governed by CEBPA protein.

Human

E. coli

N-His

P49715-1 (M1-A358)

1050

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

Approximately 44 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.