CG alpha Protein, Human (HEK293)

CG alpha, a glycoprotein hormone subunit, contributes to chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone. While alpha subunits are identical, beta chains confer specificity. Encoded by this gene, CG alpha belongs to the glycoprotein hormones alpha chain family. Restrictedly expressed in the placenta (RPKM 388.3). Two transcript variants exist. CG alpha Protein, Human (HEK293) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with tag free. The total length of CG alpha Protein, Human (HEK293) is 92 a.a., with molecular weight of ~11.86 & 15-22 kDa, respectively.

CG alpha Protein, the encoded alpha subunit of the human glycoprotein hormones, including chorionic gonadotropin (CG), luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH), plays a pivotal role in forming noncovalent dimers with beta subunits, conferring biological specificity to each hormone. While the alpha subunits are identical across these hormones, their unique beta chains determine their distinct functions. CG alpha belongs to the glycoprotein hormones alpha chain family and is expressed predominantly in the placenta (RPKM 388.3). The restricted expression pattern highlights its specialization in placental tissues, where it contributes to the regulatory functions of glycoprotein hormones crucial for reproductive and endocrine processes. Two transcript variants, encoding different isoforms, have been identified for this gene, adding to the complexity of its regulatory mechanisms in various physiological contexts.

Human

HEK293

Tag Free

NP_000726.1 (A25-S116)

1081  [NCBI]

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Approximately 11.86&15-22 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.