1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CHD1L Protein, Human (His-SUMO)

CHD1L Protein, Human (His-SUMO)

Cat. No.: HY-P71588
Handling Instructions

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of CHD1L Protein, Human (His-SUMO) is 194 a.a., with molecular weight of ~37.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of CHD1L Protein, Human (His-SUMO) is 194 a.a., with molecular weight of ~37.3 kDa.

Background

ABCB8 serves as the ATP-binding subunit of the mitochondrial potassium channel situated in the mitochondrial inner membrane. Teaming up with CCDC51/MITOK, it forms a protein complex localized within the mitochondria, facilitating ATP-dependent potassium currents across the inner membrane, known as the mitoK(ATP) channel. Additionally, ABCB8 plays a crucial role in mitochondrial iron transport and is essential for maintaining normal cardiac function, potentially influencing mitochondrial iron export and regulating the maturation of cytosolic iron sulfur cluster-containing enzymes. Notably, the channel activity is modulated by ATP through the ABCB8/MITOSUR subunit.

Species

Human

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q86WJ1 (S704-P897)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CHD1L (S704-P897)
Accession # Q86WJ1
C-term
Synonyms
ALC1; Amplified in liver cancer 1; Amplified in liver cancer protein 1; chd1l; CHD1L_HUMAN; CHDL; Chromodomain helicase DNA binding protein 1 like; Chromodomain-helicase-DNA-binding protein 1-like; FLJ22530
AA Sequence

SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP

Molecular Weight

Approximately 37.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CHD1L Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHD1L Protein, Human (His-SUMO)
Cat. No.:
HY-P71588
Quantity:
MCE Japan Authorized Agent: