1. Recombinant Proteins
  2. Others
  3. CLIC4/Chloride intracellular channel 4 Protein, Human (His)

CLIC4/Chloride intracellular channel 4 Protein, Human (His)

Cat. No.: HY-P70120
Handling Instructions Technical Support

CLIC4/Chloride The intracellular channel 4 protein inserts into the membrane to form a pH-dependent, poorly selective ion channel that transports chloride ions.It enhances cell surface expression of HRH3 and maintains membrane polarity during angiogenesis, mitosis, cytokinesis, endothelial cell proliferation, and morphogenesis.CLIC4/Chloride intracellular channel 4 Protein, Human (His) is the recombinant human-derived CLIC4/Chloride intracellular channel 4 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLIC4/Chloride The intracellular channel 4 protein inserts into the membrane to form a pH-dependent, poorly selective ion channel that transports chloride ions.It enhances cell surface expression of HRH3 and maintains membrane polarity during angiogenesis, mitosis, cytokinesis, endothelial cell proliferation, and morphogenesis.CLIC4/Chloride intracellular channel 4 Protein, Human (His) is the recombinant human-derived CLIC4/Chloride intracellular channel 4 protein, expressed by E.coli , with N-6*His labeled tag.

Background

CLIC4, known as Chloride Intracellular Channel 4, has the ability to insert into membranes, forming ion channels with poor selectivity, potentially facilitating chloride ion transport. Its channel activity is pH-dependent and its membrane insertion appears to be redox-regulated, occurring specifically under oxidizing conditions. Beyond ion transport, CLIC4 plays diverse roles, including promoting cell-surface expression of HRH3 and participating in various cellular functions such as angiogenesis, maintenance of apical-basolateral membrane polarity during mitosis and cytokinesis, as well as regulation of endothelial cell proliferation and morphogenesis. It is a part of a multimeric complex involving cytoskeletal proteins like actin, ezrin, alpha-actinin, gelsolin, IQGAP1, and CLIC5A. CLIC4 interacts directly with brain dynamin I within a complex containing actin, tubulin, and 14-3-3 isoforms, and it also interacts with HRH3 and AKAP9.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y696 (M1-K253)

Gene ID
Molecular Construction
N-term
6*His
CLIC4 (M1-K253)
Accession # Q9Y696
C-term
Synonyms
rHuChloride intracellular channel protein 4/CLIC4, His; Chloride Intracellular Channel Protein 4; Intracellular Chloride Ion Channel Protein p64H1; CLIC4
AA Sequence

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLIC4/Chloride intracellular channel 4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLIC4/Chloride intracellular channel 4 Protein, Human (His)
Cat. No.:
HY-P70120
Quantity:
MCE Japan Authorized Agent: