1. Recombinant Proteins
  2. Others
  3. CIRBP Protein, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag. The total length of CIRBP Protein, Mouse (His) is 172 a.a., with molecular weight of ~24 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

CIRBP Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE CIRBP Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag. The total length of CIRBP Protein, Mouse (His) is 172 a.a., with molecular weight of ~24 kDa.

Background

CIRBP, the cold-inducible mRNA binding protein, emerges as a crucial component in the cellular response to genotoxic stress, exerting a protective function by stabilizing transcripts associated with cell survival. This multifaceted protein plays a pivotal role in stress granule (SG) assembly when overexpressed and is essential for the cold-induced suppression of cell proliferation. Its functional versatility includes acting as both a translational repressor and activator, with a specific affinity for the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts like RPA2 and TXN. Furthermore, CIRBP forms interactions with EIF4G1 and associates with ribosomes, underscoring its involvement in intricate regulatory mechanisms at the molecular level.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P60824 (M1-E172)

Gene ID
Molecular Construction
N-term
6*His
CIRBP (M1-E172)
Accession # P60824
C-term
Synonyms
Cirbp; CirpCold-inducible RNA-binding protein; A18 hnRNP; Glycine-rich RNA-binding protein CIRP
AA Sequence

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Weight

Approximately 24 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CIRBP Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CIRBP Protein, Mouse (His)
Cat. No.:
HY-P72145
Quantity:
MCE Japan Authorized Agent: