CIRBP Protein, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag. The total length of CIRBP Protein, Mouse (His) is 172 a.a., with molecular weight of ~24 kDa.

CIRBP, the cold-inducible mRNA binding protein, emerges as a crucial component in the cellular response to genotoxic stress, exerting a protective function by stabilizing transcripts associated with cell survival. This multifaceted protein plays a pivotal role in stress granule (SG) assembly when overexpressed and is essential for the cold-induced suppression of cell proliferation. Its functional versatility includes acting as both a translational repressor and activator, with a specific affinity for the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts like RPA2 and TXN. Furthermore, CIRBP forms interactions with EIF4G1 and associates with ribosomes, underscoring its involvement in intricate regulatory mechanisms at the molecular level.

Mouse

E. coli

N-6*His

P60824 (M1-E172)

12696  [NCBI]

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Approximately 24 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.