1. Recombinant Proteins
  2. Others
  3. Claudin-18/CLDN18.1 Protein, Human (His)

CLDN18-VLPs (Claudin 18 virus-like particles) play a crucial role in alveolar fluid homeostasis by modulating tight junction composition, affecting ion transport and solute permeability. They contribute to alveolarization and the paracellular epithelial barrier, affecting epithelial progenitor cell proliferation and organ size by controlling YAP1 subcellular localization. Claudin-18/CLDN18.1 Protein, Human (His) is the recombinant human-derived Claudin-18/CLDN18.1 protein, expressed by E. coli , with N-8*His labeled tag. The total length of Claudin-18/CLDN18.1 Protein, Human (His) is 49 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLDN18-VLPs (Claudin 18 virus-like particles) play a crucial role in alveolar fluid homeostasis by modulating tight junction composition, affecting ion transport and solute permeability. They contribute to alveolarization and the paracellular epithelial barrier, affecting epithelial progenitor cell proliferation and organ size by controlling YAP1 subcellular localization. Claudin-18/CLDN18.1 Protein, Human (His) is the recombinant human-derived Claudin-18/CLDN18.1 protein, expressed by E. coli , with N-8*His labeled tag. The total length of Claudin-18/CLDN18.1 Protein, Human (His) is 49 a.a., with molecular weight of ~18.0 kDa.

Background

CLDN18-VLPs (Claudin 18 virus-like particles) play a crucial role in alveolar fluid homeostasis by regulating the composition of tight junctions in alveolar epithelial cells, impacting ion transport, and solute permeability, potentially through the modulation of actin cytoskeleton organization and beta-2-adrenergic signaling. Essential for lung alveolarization and the maintenance of the paracellular alveolar epithelial barrier, CLDN18-VLPs contribute to epithelial progenitor cell proliferation and organ size regulation by controlling the subcellular localization of YAP1 and restricting its target gene transcription. Additionally, CLDN18-VLPs act as a negative regulator of RANKL-induced osteoclast differentiation, possibly by influencing the subcellular distribution of TJP2/ZO-2 and participating in bone resorption in response to calcium deficiency. They mediate the osteoprotective effects of estrogen independently of RANKL signaling pathways. Furthermore, CLDN18-VLPs are implicated in maintaining the alveolar microenvironment homeostasis by regulating pH and subsequent T-cell activation, indirectly contributing to the limitation of C. neoformans infection.

Species

Human

Source

E. coli

Tag

N-8*His

Accession

P56856-1 (D28-L76)

Gene ID
Molecular Construction
N-term
8*His
CLDN18 (D28-L76)
Accession # P56856-1
C-term
Synonyms
rHuClaudin-18/CLDN18, His; Claudin-18; CLDN18
AA Sequence

DMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAML

Molecular Weight

Approximately 19.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 8% Sucrose, 2% Glycine, 20% Glycerol, 5mM DTT, 0.05% Tween 80, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Claudin-18/CLDN18.1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-18/CLDN18.1 Protein, Human (His)
Cat. No.:
HY-P70045
Quantity:
MCE Japan Authorized Agent: