2. Recombinant Proteins
  3. Biotinylated Proteins
  4. Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293)

Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293)

Cat. No.: HY-P77900
COA Handling Instructions

Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293) is available in solution form, no concentration information, recommended only for SPR analysis. HY-P77899 can be used in animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
20 μL Get quote
100 μL Get quote

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293) is available in solution form, no concentration information, recommended only for SPR analysis. HY-P77899 can be used in animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
Species

Human
Source

HEK293
Tag

Tag Free
Accession

P56747 (M1-V220)
Gene ID
Molecular Construction
N-term
CLDN6 (M1-V220)
Accession # P56747
C-term
Synonyms
Claudin-6; Skullin; CLDN6; Claudin6; Skullin 2
AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Molecular Weight

Approximately 24.5 kDa
Purity

Greater than 95% as determined by HPLC.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation

COA (205 KB)

Handling Instructions (2659 KB)

Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293)
Cat. No.:
HY-P77900
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.