Claudin-18/CLDN18.2 Protein, Human (His)

CLDN18 play a crucial role in alveolar fluid homeostasis by modulating tight junction composition, affecting ion transport and solute permeability. They contribute to alveolarization and the paracellular epithelial barrier, affecting epithelial progenitor cell proliferation and organ size by controlling YAP1 subcellular localization. Claudin-18/CLDN18.2 Protein, Human (His) is the recombinant human-derived Claudin-18/CLDN18.2 protein, expressed by E. coli , with N-8*His labeled tag. The total length of Claudin-18/CLDN18.2 Protein, Human (His) is 49 a.a., with molecular weight of ~18.0 kDa.

CLDN18 play a crucial role in alveolar fluid homeostasis by regulating the composition of tight junctions in alveolar epithelial cells, impacting ion transport, and solute permeability, potentially through the modulation of actin cytoskeleton organization and beta-2-adrenergic signaling. Essential for lung alveolarization and the maintenance of the paracellular alveolar epithelial barrier, CLDN18-VLPs contribute to epithelial progenitor cell proliferation and organ size regulation by controlling the subcellular localization of YAP1 and restricting its target gene transcription. Additionally, CLDN18-VLPs act as a negative regulator of RANKL-induced osteoclast differentiation, possibly by influencing the subcellular distribution of TJP2/ZO-2 and participating in bone resorption in response to calcium deficiency. They mediate the osteoprotective effects of estrogen independently of RANKL signaling pathways. Furthermore, CLDN18-VLPs are implicated in maintaining the alveolar microenvironment homeostasis by regulating pH and subsequent T-cell activation, indirectly contributing to the limitation of C. neoformans infection.

Human

E. coli

N-8*His

P56856-2 (D28-L76)

51208  [NCBI]

DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAML

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 25 mM Tris-HCl, 25 mM NaCl, 0.1% Triton X-100, 10% glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.