CLEC10A/CD301 Protein, Human (HEK293, His)

CLEC10A/CD301 Protein, implicated in probable immune response regulation, binds Tn-Ag sugar moieties in a calcium-dependent manner. Recognizing these structures on carcinoma cells, CLEC10A/CD301 suggests a role in immune surveillance. Further exploration of its molecular interactions and downstream signaling pathways will enhance understanding of its contributions to immune modulation, especially in the context of cancer immunity. CLEC10A/CD301 Protein, Human (HEK293, His) is the recombinant human-derived CLEC10A/CD301 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CLEC10A/CD301 Protein, Human (HEK293, His) is 256 a.a., with molecular weight of ~40 kDa.

The CLEC10A/CD301 protein is implicated in the probable regulation of adaptive and innate immune responses. Functioning in a calcium-dependent manner, it binds to terminal galactose and N-acetylgalactosamine units, specifically those linked to serine or threonine. These sugar moieties, known as Tn-Ag, are expressed in various carcinoma cells. The involvement of CLEC10A/CD301 in recognizing and binding to these specific carbohydrate structures suggests a potential role in immune surveillance, particularly in the context of carcinoma cells. Further exploration of the molecular interactions and downstream signaling pathways influenced by CLEC10A/CD301 will enhance our understanding of its contributions to immune modulation and its potential implications in cancer immunity.

Human

HEK293

C-6*His

Q8IUN9 (Q61-H316)

10462  [NCBI]

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Approximately 40 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.