CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc)

CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc) is the recombinant rhesus macaque-derived CLEC4E, expressed by HEK293 , with N-hFc labeled tag. The total length of CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc) is 179 a.a.,

CLEC4E Protein facilitates uptake of antigens and is involved in the routing or processing of antigen for presentation to T cells. C-type lectin domain family 4 member E is a major receptor on primary langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. C-type lectin domain family 4 member E protects against human immunodeficiency virus-1 (HIV-1) infection^[1][2][3][4].

Immobilized Trehalose 6, 6'-Dimycolate at 1μg/mL (100μL/well) can bind Rhesus Macaque CLEC4E Protein. The ED₅₀ for this effect is 0.1206 μg/mL.

• 
  Immobilized Trehalose 6, 6'-Dimycolate at 1 μg/mL (100μL/well) can bind Rhesus Macaque CLEC4E Protein. The ED₅₀ for this effect is 0.1206 μg/mL.

Rhesus Macaque

HEK293

N-hFc

XP_001118423.1 (R41-I219)

722250

RCVVTYHIFQSCDEKKFQLHENFTELSCYNDGSGSVKNCCPSNWEYFQSSCYFFSTDTIPWTSSLKNCSAMGAHLVIINSQEEQEFLAYKKPKMKEFFIGLSDKVVEGQWHWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDATCFFSYFRICERLGINILNKGKSI

Approximately 50-70 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.