2. Recombinant Proteins
  3. Receptor Proteins
  4. Pattern Recognition Receptors
  5. C-type Lectin Receptors
  6. CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc)

CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc)

Cat. No.: HY-P77336A
Data Sheet
SDS
COA
Handling Instructions Technical Support

Protein solubilization and storage

Help & FAQs

CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc) is the recombinant rhesus macaque-derived CLEC4E, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 53 In-stock
10 μg USD 85 In-stock
50 μg USD 240 In-stock
100 μg   Get quote  

Get it by May 1 for select sizes. Order within 11 hrs 20 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc) is the recombinant rhesus macaque-derived CLEC4E, expressed by HEK293 , with N-hFc labeled tag.
Background

CLEC4E Protein facilitates uptake of antigens and is involved in the routing or processing of antigen for presentation to T cells. C-type lectin domain family 4 member E is a major receptor on primary langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. C-type lectin domain family 4 member E protects against human immunodeficiency virus-1 (HIV-1) infection[1][2][3][4].
Biological Activity

Immobilized Trehalose 6, 6'-Dimycolate at 1μg/mL (100μL/well) can bind Rhesus Macaque CLEC4E Protein. The ED50 for this effect is 0.1206 μg/mL.

  • Immobilized Trehalose 6, 6'-Dimycolate at 1 μg/mL (100μL/well) can bind Rhesus Macaque CLEC4E Protein. The ED50 for this effect is 0.1206 μg/mL.
Species

Rhesus Macaque
Source

HEK293
Tag

N-hFc
Accession

XP_001118423.1 (R41-I219)
Gene ID

722250
Synonyms
C-Type Lectin Domain Family 4 Member E; CLECSF9; MINCLE
AA Sequence

RCVVTYHIFQSCDEKKFQLHENFTELSCYNDGSGSVKNCCPSNWEYFQSSCYFFSTDTIPWTSSLKNCSAMGAHLVIINSQEEQEFLAYKKPKMKEFFIGLSDKVVEGQWHWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDATCFFSYFRICERLGINILNKGKSI

Molecular Weight

Approximately 50-70 kDa due to the glycosylation.
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US; may vary elsewhere.
Documentation
Data Sheet (236 KB) SDS (251 KB)

COA (206 KB)

Handling Instructions (2659 KB)

CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC4E Protein, Rhesus Macaque (HEK293, N-hFc)
Cat. No.:
HY-P77336A
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.