Fc gamma RIIB/CD32b Protein, Rat (HEK293, His)

Fc gamma RIIB/CD32b Protein plays a crucial role, specifically binding to the Fc region of immunoglobulins gamma as a low-affinity receptor. Binding to IgG, it initiates cellular responses against pathogens, highlighting its immune system modulation. Interactions with FGR and LYN underscore its role in signaling pathways, emphasizing its significance in mediating cellular responses and contributing to immune defense against diverse antigens. Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) is the recombinant rat-derived Fc gamma RIIB/CD32b protein, expressed by HEK293, with C-His labeled tag. The total length of Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) is 181 a.a., with molecular weight of 30-50 KDa.

The Fc gamma RIIB/CD32b protein assumes a crucial role as it specifically binds to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its binding to IgG, Fc gamma RIIB/CD32b initiates cellular responses against pathogens and soluble antigens, highlighting its involvement in immune system modulation. The protein's interactions with FGR and LYN further emphasize its role in intricate signaling pathways, underlining its significance in mediating cellular responses and contributing to immune defense mechanisms against diverse antigens.

Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 0.3838 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 0.3838 μg/mL.

Rat

HEK293

C-His

Q63203 (H32-P212)

289211  [NCBI]

HAGLPKAVVKLEPPWIQVLKEDTVTLMCEGTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDWLLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQEPKSSSSLP

30-50 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.