Langerin/CD207 Protein, Human (HEK293, His)

CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.

CLC4K protein, a calcium-dependent lectin encoded by CD207, belongs to the C-type lectin domain family. CLC4K has mannose-binding specificity and is involved in antigen presentation to T cells. CLC4K is the major receptor for Candida, Saccharomyces, and Malassezia furfur on primary Langerhans cells. Langerhans cells are specialized antigen-presenting cells located within the epithelium of the epidermis and mucosa. Upon contact with Langerhans cells, pathogens are captured by the C-type lectin langerin and internalized into structurally unique vesicles called Birbeck granules (BGs). CLC4K induces the formation of Birbeck granules and protects against human immunodeficiency virus 1 (HIV-1) infection. Molecular mechanisms for membrane zipping exist during Birbeck granule biogenesis, and CLC4K is a potent regulator of membrane stacking and zipping. CLC4K binds to high-mannose structures present on the envelope glycoprotein and subsequently targets the virus to Birbeck particles, causing their rapid degradation. Langerhans cell histiocytosis (LCH) is a disorder characterized by clonal expansion of myeloid precursor cells that differentiate into CD1a1/CD207 cells within the lesion. Therefore, detection of clonal tumor proliferation with expression of CD1a, CD207 (Langerin), and S100 can help diagnose LCH.

Human

HEK293

N-6*His

AAH22278.1 (Y64-P328)

50489  [NCBI]

YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

30-40 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.