CNTF Protein, Human (His)

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family^[1]. CNTF could protect retinal cone and rod photoreceptors^[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons^[3]. CNTF Protein, Human (His) is produced by E. coli (A2-M200) with N-terminal His-tag.

Ciliary Neurotrophic Factor (CNTF) belongs to the IL-6 cytokine family. IL-6, IL-11 and CNTF are associated with cytokine trans signaling. CNTF shows a low affinity interaction with IL-6 receptor subunit alpha (IL-6Rα), leading to the formation and activation of the IL-6Rβ/gp130/LIFR signaling receptor complex^[1]. CNTF is also an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells^[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes^[3]. The similarity of human CNTF protein sequences to mice and rats was 81.82% and 84.0%, respectively.

CNTF (human; 2 ng/mL; 3 d) significantly inhibits the activity of choline acetyltransferase (ChAT) in mesencephalic cultures^[4].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is typically 1-4 μg/mL.

Human

E. coli

N-His

P26441 (A2-M200)

1270  [NCBI]

AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

27-30 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18(12):773-789.  [Content Brief]

  [2]. Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293(39):15256-15268.  [Content Brief]

  [3]. Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17(7):912-21.  [Content Brief]

  [4]. Zurn A D, et al. Combined effects of GDNF, BDNF, and CNTF on motoneuron differentiation in vitro[J]. Journal of neuroscience research, 1996, 44(2): 133-141.