Cornulin Protein, Human (His)

Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cornulin Protein, Human (His) is 140 a.a., with molecular weight of ~17.0 kDa.

Cornulin Protein takes on a pivotal role in cellular dynamics by promoting cell proliferation and facilitating G1/S cell cycle progression. Its influence extends to the induction of CCND1, a crucial cell cycle regulator. Furthermore, Cornulin orchestrates the regulation of proliferation in response to pro-inflammatory cytokines, actively engaging the NFKB1 and PI3K/AKT signaling pathways. Operating as a homodimer, Cornulin emerges as a multifaceted player in cellular processes, contributing to the intricate balance of cell cycle control and response to inflammatory cues. The orchestrated interplay of Cornulin in these pathways underscores its significance in regulating cellular proliferation and highlights its potential implications in physiological and pathological contexts. Further exploration is warranted to comprehensively understand the specific molecular mechanisms underlying Cornulin's intricate involvement in cell cycle regulation and its responsiveness to pro-inflammatory stimuli.

Human

E. coli

N-6*His

Q9UBG3 (M1-S140)

49860  [NCBI]

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.