CPLX2/Complexin-2 Protein, Human (His)

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag. The total length of CPLX2/Complexin-2 Protein, Human (His) is 133 a.a., with molecular weight of ~21 KDa.

Complexin-2 (CPLX2) protein assumes a pivotal role in modulating synaptic vesicle dynamics within postmitotic neurons. It acts as a negative regulator, specifically impeding the formation of synaptic vesicle clusters at the active zone, thereby influencing the precise localization of vesicles to the presynaptic membrane. Intriguingly, CPLX2 also exhibits a positive regulatory impact on the later stages of exocytosis, participating in the release of various cytoplasmic vesicles, including synaptic vesicles and other secretory vesicles. Its involvement extends to mast cell exocytosis, underlining its versatile role in cellular processes. Notably, CPLX2 achieves these regulatory effects through direct binding to the SNARE core complex, a molecular ensemble encompassing SNAP25, VAMP2, and STX1A, thereby contributing to the intricate orchestration of neurotransmitter release and vesicle dynamics at the synapse.

Human

E. coli

N-His

Q6PUV4 (D2-K134)

10814  [NCBI]

DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

Approximately 21 kDa.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.