1. Recombinant Proteins
  2. Others
  3. CPLX3 Protein, Human (HEK293, His)

CPLX3 Protein, Human (HEK293, His)

Cat. No.: HY-P76848
SDS COA Handling Instructions

CPLX3 protein is a complex protein that regulates synaptic vesicle fusion through the SNARE protein complex. CPLX3 Protein, Human (HEK293, His) is the recombinant human-derived CPLX3 protein, expressed by HEK293 , with N-His labeled tag. The total length of CPLX3 Protein, Human (HEK293, His) is 154 a.a., with molecular weight of 27-33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $80 In-stock
50 μg $210 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CPLX3 protein is a complex protein that regulates synaptic vesicle fusion through the SNARE protein complex. CPLX3 Protein, Human (HEK293, His) is the recombinant human-derived CPLX3 protein, expressed by HEK293 , with N-His labeled tag. The total length of CPLX3 Protein, Human (HEK293, His) is 154 a.a., with molecular weight of 27-33 kDa.

Background

CPLX3, a complexin protein, intricately modulates the SNARE protein complex, thereby playing a pivotal role in the regulation of synaptic vesicle fusion. Its significance extends to the maintenance of synaptic ultrastructure in the adult retina, highlighting its involvement in fundamental neuronal processes. Functionally, CPLX3 exerts a positive influence on synaptic transmission by modulating the availability of synaptic vesicles and facilitating neurotransmitter exocytosis, particularly at photoreceptor ribbon synapses in the retina. Additionally, CPLX3 contributes to the suppression of tonic photoreceptor activity and baseline 'noise' through the inhibition of Ca(2+) vesicle tonic release, while promoting evoked synchronous and asynchronous Ca(2+) vesicle release. The molecular basis of its regulatory role lies in its interaction with the SNARE core complex, specifically binding to SNAP25, VAMP2, and STX1A, underscoring its multifaceted involvement in the intricate machinery of neuronal communication.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q8WVH0 (M1-K154)

Gene ID
Molecular Construction
N-term
His
CPLX3 (M1-K154)
Accession # Q8WVH0
C-term
Synonyms
Complexin-3; Complexin III; CPX III
AA Sequence

MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEK

Molecular Weight

Approximately 27-33 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CPLX3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CPLX3 Protein, Human (HEK293, His)
Cat. No.:
HY-P76848
Quantity:
MCE Japan Authorized Agent: