CPLX3 Protein, Human (HEK293, His)

CPLX3 protein is a complex protein that regulates synaptic vesicle fusion through the SNARE protein complex. CPLX3 Protein, Human (HEK293, His) is the recombinant human-derived CPLX3 protein, expressed by HEK293 , with N-His labeled tag. The total length of CPLX3 Protein, Human (HEK293, His) is 154 a.a., with molecular weight of 27-33 kDa.

CPLX3, a complexin protein, intricately modulates the SNARE protein complex, thereby playing a pivotal role in the regulation of synaptic vesicle fusion. Its significance extends to the maintenance of synaptic ultrastructure in the adult retina, highlighting its involvement in fundamental neuronal processes. Functionally, CPLX3 exerts a positive influence on synaptic transmission by modulating the availability of synaptic vesicles and facilitating neurotransmitter exocytosis, particularly at photoreceptor ribbon synapses in the retina. Additionally, CPLX3 contributes to the suppression of tonic photoreceptor activity and baseline 'noise' through the inhibition of Ca(2+) vesicle tonic release, while promoting evoked synchronous and asynchronous Ca(2+) vesicle release. The molecular basis of its regulatory role lies in its interaction with the SNARE core complex, specifically binding to SNAP25, VAMP2, and STX1A, underscoring its multifaceted involvement in the intricate machinery of neuronal communication.

Human

HEK293

N-6*His

Q8WVH0 (M1-K154)

594855  [NCBI]

MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEK

Approximately 27-33 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.