1. Recombinant Proteins
  2. Others
  3. CRISP-3 Protein, Human (HEK293, His)

The CRISP-3 protein interacts with A1BG, indicating a molecular association with potential functional implications. This suggests that CRISP-3 may be involved in processes associated with or regulated by A1BG. The specific nature and significance of this interaction require further elucidation, emphasizing the need for additional investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction. CRISP-3 Protein, Human (HEK293, His) is the recombinant human-derived CRISP-3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CRISP-3 protein interacts with A1BG, indicating a molecular association with potential functional implications. This suggests that CRISP-3 may be involved in processes associated with or regulated by A1BG. The specific nature and significance of this interaction require further elucidation, emphasizing the need for additional investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction. CRISP-3 Protein, Human (HEK293, His) is the recombinant human-derived CRISP-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CRISP-3 protein engages in interaction with A1BG, suggesting a molecular association between CRISP-3 and A1BG. This interaction hints at potential functional implications, with CRISP-3 likely playing a role in processes associated with or regulated by A1BG. The specific nature and significance of this interaction remain to be fully elucidated, underscoring the need for further investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P54108 (N21-Y245)

Gene ID
Molecular Construction
N-term
CRISP-3 (N21-Y245)
Accession # P54108
6*His
C-term
Synonyms
rHuCysteine-rich secretory protein 3/CRISP-3, His; Cysteine-Rich Secretory Protein 3; CRISP-3; Specific Granule Protein of 28 kDa; SGP28; CRISP3
AA Sequence

NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY

Molecular Weight

25-32 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CRISP-3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRISP-3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70042
Quantity:
MCE Japan Authorized Agent: