CSRP1 Protein, Human (His)

The CSRP1 protein is a protein that may be involved in neuronal development. It is known to interact with three other proteins: ASCC1, ASCC2 and TRIP4. CSRP1 Protein, Human (His) is the recombinant human-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag. The total length of CSRP1 Protein, Human (His) is 193 a.a., with molecular weight of ~22 KDa.

CSRP1 Protein is a protein that shows potential involvement in the development of neurons. It is known to interact with three other proteins: ASCC1, ASCC2, and TRIP4. The precise function of CSRP1 Protein in neuronal development is not fully understood; however, its interaction with these proteins suggests its participation in various cellular processes and signaling pathways that contribute to the intricate process of neuronal development. Further research is needed to uncover the precise mechanisms by which CSRP1 Protein influences neuronal development and how its interactions with ASCC1, ASCC2, and TRIP4 contribute to this process.

Human

E. coli

C-His

P21291 (M1-E193)

1465  [NCBI]

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

Approximately 22 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.