Cardiotrophin-1/CTF1 Protein, Mouse (HEK293)

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.

Cardiotrophin-1 (CT-1) is required for cardiac myocyte maturation and is capable of promoting cell survival in neonatal rat cardiomyocytes subjected to serum deprivation through an antiapoptotic pathway mediated by MAPK, ERK1/2CT1^[1]. CT-1 exhibits impressive neuroprotective effects and delay the procession of motor neuron degenerative disorders by prolonging the median neuronal survival time, improving motor function and promoting regeneration in neonatal rat motor neurons in mouse models of amyotrophic lateral sclerosis, progressive motor neuropathy and spinal muscular atrophy and in adult rats with spinal cord injuries^[2].

The ED₅₀ is <1.25 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >0.8 × 10⁶ units/mg.

Mouse

HEK293

Tag Free

Q60753 (S2-A203)

13019  [NCBI]

SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

22-27 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. López-Yoldi M, et al. Cardiotrophin-1: A multifaceted cytokine. Cytokine Growth Factor Rev. 2015 Oct;26(5):523-32.  [Content Brief]

  [2]. Peng L, et al. Cardiotrophin-1 stimulates the neural differentiation of human umbilical cord blood-derived mesenchymal stem cells and survival of differentiated cells through PI3K/Akt-dependent signaling pathways. Cytotechnology. 2017 Dec;69(6):933-941.  [Content Brief]