1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CTLA-4 CTLA-4
  5. CTLA-4 Protein, Mouse (HEK293, His)

CTLA-4 Protein, Mouse (HEK293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CTLA-4 Protein, Mouse (HEK293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells[1][2].

Background

CTLA-4 and CD28 both belongs to a family of immunoglobulin-related receptors that are responsible for various aspects of T-cell immune regulation. CTLA-4 and CD28 are homologous receptors expressed by both CD4+ and CD8+ T cells, which mediate opposing functions in T cell activation[1].
CTLA-4 interacts with both ligands (CD80 and CD86) with high affinity[1].
CTLA-4 is a negative immune regulator constitutively expressed on Treg cells and upregulated on activated T cells. CTLA-4 inhibits T cell activation by various suppressive functions including competition with CD28, regulation of the inhibitory function of Treg cells, such as transendocytosis, and the control of adhesion and motility[1].

Biological Activity

The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P09793 (A37-D161)

Gene ID
Molecular Construction
N-term
CTLA-4 (A37-D161)
Accession # P09793
6*His
C-term
Synonyms
Ctla4; Cd152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
AA Sequence

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Weight

14-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

CTLA-4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTLA-4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71991
Quantity:
MCE Japan Authorized Agent: