CTLA-4 Protein, Mouse (HEK293, His)

CTLA-4 Protein, Mouse (HEK293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells^[1][2].

CTLA-4 and CD28 both belongs to a family of immunoglobulin-related receptors that are responsible for various aspects of T-cell immune regulation. CTLA-4 and CD28 are homologous receptors expressed by both CD4+ and CD8+ T cells, which mediate opposing functions in T cell activation^[1].
CTLA-4 interacts with both ligands (CD80 and CD86) with high affinity^[1].
CTLA-4 is a negative immune regulator constitutively expressed on Treg cells and upregulated on activated T cells. CTLA-4 inhibits T cell activation by various suppressive functions including competition with CD28, regulation of the inhibitory function of Treg cells, such as transendocytosis, and the control of adhesion and motility^[1].

The ED₅₀ as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/mL.

Mouse

HEK293

C-6*His

P09793 (A37-D161)

12477  [NCBI]

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

14-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Behzad Rowshanravan, et al. CTLA-4: a moving target in immunotherapy. Blood. 2018 Jan 4;131(1):58-67.  [Content Brief]

  [2]. Noriko Mitsuiki, et al. What did we learn from CTLA-4 insufficiency on the human immune system?Immunol Rev. 2019 Jan;287(1):33-49.  [Content Brief]