CTRL-1 Protein, Human (HEK293, His)

CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CTRL-1 Protein, Human (HEK293, His) is 246 a.a., with molecular weight of 28-38 kDa.

The CTRL-1 Protein is an essential member of the peptidase S1 family, signifying its crucial role as a serine protease enzyme. As part of this enzyme family, CTRL-1 likely shares conserved structural and functional features with related proteins, indicating its involvement in catalyzing the hydrolysis of peptide bonds. The membership in the peptidase S1 family underscores its significance in cellular processes related to proteolysis and the regulation of various biological pathways. The study of CTRL-1 provides insights into its specific enzymatic functions within the context of the peptidase S1 family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in protein metabolism. Further exploration of CTRL-1's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

P40313 (C19-N264)

1506  [NCBI]

CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

28-38 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.