1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. GRO-alpha
  6. GRO-alpha/CXCL1 Protein, Mouse (His)

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of 11.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of 11.5 kDa.

Background

GRO-alpha (CXCL1) Protein exhibits chemotactic properties, attracting neutrophils and contributing to their activation during inflammatory responses. Additionally, this hematoregulatory chemokine displays the ability to suppress the proliferation of hematopoietic progenitor cells, highlighting its intricate role in regulating hematopoiesis. Notably, the truncated form KC(5-72) exhibits significantly enhanced hematopoietic activity in vitro.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P12850 (N29-K96)

Gene ID
Molecular Construction
N-term
6*His
CXCL1 (N29-K96)
Accession # P12850
C-term
Synonyms
Growth-Regulated Alpha Protein; C-X-C Motif Chemokine 1; GRO-Alpha(1-73); Melanoma Growth Stimulatory Activity; MGSA; Neutrophil-Activating Protein 3; NAP-3; CXCL1; GRO; GRO1; GROA; MGSA; SCYB1
AA Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Molecular Weight

11.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GRO-alpha/CXCL1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRO-alpha/CXCL1 Protein, Mouse (His)
Cat. No.:
HY-P700559
Quantity:
MCE Japan Authorized Agent: