1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SDF-1/CXCL12
  6. CXCL12/SDF-1 beta
  7. SDF-1 beta/CXCL12 Protein, Mouse

SDF-1 beta/CXCL12 Protein, Mouse

Cat. No.: HY-P72782
COA Handling Instructions

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $85 In-stock
10 μg $230 In-stock
50 μg $630 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

SDF-1 beta/CXCL12 Protein, Mouse Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93).

Background

The chemokine stromal-derived factor-1 (SDF-1), which is constitutively expressed in most tissues as SDF-1α and SDF-1β resulting from alternative gene splicing, regulates hematopoiesis, lymphocyte homing, B-lineage cell growth, and angiogenesis[1][2]. SDF-1β is assigned to the intercrine cytokine family (chemokines) which is characterized by four conserved cysteines that form two disulfide bonds. Furthermore its expression is found in all organs except in blood cells[3].
SDF-1β which is virtually the same as SDF-1α, except in that the fourth exon consists of only four residues attached to a C-terminus, shows very similar activity in vitro and in tissues, but is twice as potent in the blood. SDF-1α comprises 3 exons and encodes a protein of 89 amino acids whereas SDF-1β consists of 4 exons and encodes a protein of 93 amino acids. Both isoforms are highly similar regarding their sequences with the only difference of 4 additional amino acids at the C-terminus of SDF1β[1][2]. In addition, SDF-1β is shown to be a sufficient factor capable of supporting rodent B-cell lymphopoiesis. SDF-1β is expressed less abundantly and seems to be related to the vascular system. Its greater resistance to proteolysis within the blood predispose it to this role[3].
Endothelial cells of cerebral microvessels in mice express SDF-1β selectively. Its upregulation is found following focal cerebral ischemia and is associated with the infiltration of CXCR4-expressing peripheral blood cells, such as macrophages. SDF-1β also has a greater effect on angiogenesis in human microvascular endothelial cells (HMEC)[3]. Compared with SDF-1α, SDF-1β is more resistant to blood-dependent degradation, stimulates angiogenesis and is present in highly vascularized organs such as: the liver, spleen and kidneys[4].

In Vivo

Recombinant mouse SDF-1β (5 mg/kg; tail vein; twice a week; for 3 months) injected into mice bearing type 2 diabetes (T2D). SDF-1β prevents T2D-induced cardiac dysfunction and fibrosis and T2D-down-regulated KLF15 expression in wild-type diabetic heart tissue[5].

Biological Activity

1. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 50-100 ng/mL.
2. Measured by its ability to inhibit proliferation of Jurkat cells. The ED50 this effect is 2.589 ng/mL, corresponding to a specific activity is 3.86×10^5 units/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P40224-2 (K22-M93)

Gene ID
Molecular Construction
N-term
CXCL12 (K22-M93)
Accession # P40224-2
C-term
Synonyms
C-X-C motif chemokine 12; Stromal cell-derived factor 1; CXCL12; SDF-1β
AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

Molecular Weight

Approximately 10.74 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDF-1 beta/CXCL12 Protein, Mouse
Cat. No.:
HY-P72782
Quantity:
MCE Japan Authorized Agent: