1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SR-PSOX/CXCL16
  6. CXCL16 Protein, Mouse (HEK293, His)

CXCL16 Protein, Mouse (HEK293, His)

Cat. No.: HY-P72681
SDS COA Handling Instructions

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types. CXCL16 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 175 amino acids (N27-W201).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 175 amino acids (N27-W201).

Background

CXCL16 is a membrane-bound chemokine. CXCL16 is expressed in soluble or transmembrane forms and can be observed in many cell types, including inflammatory cells (such as macrophages, neutrophils, dendritic cells and monocytes) and non-inflammatory cells (such as lung epithelial cells and renal cells). CXCL16 plays important roles both in the natural immune barrier and in the occurrence and development of autoimmune diseases[1][2].
The amino acid sequence of human CXCL16 protein has low homology between mouse, rat and dog CXCL16 protein.
CXCL16 is primarily expressed on the surface of antigen-presenting cells (APCs) and consists of a chemokine domain (~89 amino acids), a mucin-type stalk (~110 amino acids), a single-pass transmembrane domain (~20 amino acids), and a cytoplasmic tail (~27 amino acids). CXCL16 is the only ligand of the CXCR6 receptor. Soluble CXCL16 induces the migration of CXCR6+ cells (including Th1 cells, NK cells and activated CD8 + T-cells), M2-macrophage infiltration, interactions between APC and CD8 + T-cells, the cellular immune response and inflammatory response, and the development of thymocytes. Membrane-bound CXCL16 can promote the adhesion of CXCR6+ cells. CXCL16 specifically binds oxidized low-density lipoprotein (OxLDL), leading to its internalization and degradation. CXCL16 may play important roles in the formation of atherosclerotic lesions. CXCL16 on macrophages and dendritic cells mediates the adhesion and phagocytosis of bacteria, such as Escherichia coli and Staphylococcus aureus, and bacterial recognition is mediated by the chemokine domain of CXCL16[1][2].
CXCL16 is not only a chemokine, but is also a multifunctional protein. CXCL16 and CXCR6 are related to various inflammatory diseases, such as glomerulonephritis, pulmonary diseases, atherosclerosis, coronary artery disease, rheumatoid arthritis and many inflammation-related cancers. The chemokine domain of CXCL16 exerts potent anti-microbial activities against E. coli and S. aureus. CXCL16 acts as a mediator of innate immunity by attracting CXCR6-expressing cells, such as activated T cells and NKT cells. CXCL16 is also a novel mediator of the innate immune reactivities of keratinocytes in the human epidermis[1][2][3].

In Vitro

Recombinant mouse CXCL16 (50-200 ng/mL; 0, 24, 48, and 72 hours) treatment not only contributes to the proliferation of mouse lung fibroblast L929 cells but also induces the expression of p-STAT3 in mouse lung fibroblast L929 cells[4].

In Vivo

Recombinant mouse CXCL16 (0.5-1.0 μg; i.p.) increases sepsis-induced mortality and tissue injury in a murine model of cecal ligation and puncture (CLP)-induced nonsevere sepsis[5].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8BSU2 (N27-W201)

Gene ID
Molecular Construction
N-term
CXCL16 (N27-W201)
Accession # Q8BSU2
6*His
C-term
Synonyms
C-X-C motif chemokine 16; SR-PSOX; CXCL16; SCYB16
AA Sequence

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAW

Molecular Weight

Approximately 37.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CXCL16 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCL16 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72681
Quantity:
MCE Japan Authorized Agent: