CXCL16 Protein, Mouse (His)

The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. CXCL16 Protein, Mouse (His) is the recombinant mouse-derived CXCL16 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL16 Protein, Mouse (His) is 172 a.a., with molecular weight of 22.7 kDa.

The CXCL16 protein exhibits multifaceted functionalities, including the induction of a robust chemotactic response and the initiation of calcium mobilization. Functioning as a ligand, it binds to CXCR6/Bonzo, thereby contributing to cellular signaling processes. Beyond its role as a chemotactic factor, CXCL16 serves as a scavenger receptor on macrophages, displaying a specific affinity for oxidized low-density lipoprotein (OxLDL). This interaction suggests its potential involvement in pathophysiological processes, particularly atherogenesis, where the recognition and clearance of OxLDL by macrophages play a crucial role. The diverse activities of CXCL16 highlight its versatility and underscore its potential implications in cellular responses and pathological conditions.

Mouse

E. coli

N-6*His

Q8BSU2 (N27-T198)

66102  [NCBI]

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST

22.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.