1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CXC Chemokine Receptor Chemokine Receptor
  5. CXCR4
  6. CXCR4 Protein, Human (HEK293, Fc)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (HEK293, Fc) is the recombinant human-derived CXCR4 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CXCR4 Protein, Human (HEK293, Fc) is 46 a.a., with molecular weight of 35-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (HEK293, Fc) is the recombinant human-derived CXCR4 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CXCR4 Protein, Human (HEK293, Fc) is 46 a.a., with molecular weight of 35-45 kDa.

Background

The CXCR4 Protein serves as a receptor for the C-X-C chemokine CXCL12/SDF-1, transmitting signals that increase intracellular calcium ion levels and enhance MAPK1/MAPK3 activation. It is actively involved in the AKT signaling cascade and plays a crucial role in regulating cell migration, particularly during processes like wound healing. Additionally, CXCR4 acts as a receptor for extracellular ubiquitin, leading to elevated intracellular calcium ions and reduced cellular cAMP levels. It also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Beyond its immunological functions, CXCR4 plays essential roles in hematopoiesis, cardiac ventricular septum formation, vascularization of the gastrointestinal tract, and cerebellar development. In the central nervous system, it may mediate hippocampal-neuron survival. Furthermore, in the context of microbial infection, CXCR4 acts as a coreceptor, alongside CD4, for human immunodeficiency virus-1 (HIV-1) X4 isolates and serves as a primary receptor for certain HIV-2 isolates, promoting viral fusion.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P61073-1 (M1-S46)

Gene ID
Molecular Construction
N-term
hFc
CXCR4 (M1-S46)
Accession # P61073-1
C-term
Synonyms
C-X-C chemokine receptor type 4; CXC-R4; LESTR; LAP-3; NPYRL; CD184; SDF-1 receptor
AA Sequence

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Molecular Weight

35-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl,100 mM Glycine, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCR4 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72674
Quantity:
MCE Japan Authorized Agent: