CXCR4 Protein, Human (HEK293, Fc)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (HEK293, Fc) is the recombinant human-derived CXCR4 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CXCR4 Protein, Human (HEK293, Fc) is 46 a.a., with molecular weight of 35-45 kDa.

The CXCR4 Protein serves as a receptor for the C-X-C chemokine CXCL12/SDF-1, transmitting signals that increase intracellular calcium ion levels and enhance MAPK1/MAPK3 activation. It is actively involved in the AKT signaling cascade and plays a crucial role in regulating cell migration, particularly during processes like wound healing. Additionally, CXCR4 acts as a receptor for extracellular ubiquitin, leading to elevated intracellular calcium ions and reduced cellular cAMP levels. It also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Beyond its immunological functions, CXCR4 plays essential roles in hematopoiesis, cardiac ventricular septum formation, vascularization of the gastrointestinal tract, and cerebellar development. In the central nervous system, it may mediate hippocampal-neuron survival. Furthermore, in the context of microbial infection, CXCR4 acts as a coreceptor, alongside CD4, for human immunodeficiency virus-1 (HIV-1) X4 isolates and serves as a primary receptor for certain HIV-2 isolates, promoting viral fusion.

Human

HEK293

N-hFc

P61073-1 (M1-S46)

7852  [NCBI]

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

35-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl,100 mM Glycine, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.