Cyclin E Protein, Mouse (sf9, His-GST)

Cyclin E, a vital regulator in cell cycle control, governs the G1/S transition by forming a potent serine/threonine kinase complex with CDK2. This complex, featuring UHRF2, CDK2, and CCNE1, involves Cyclin E's direct interaction with UHRF2, leading to CCNE1 ubiquitination independently of phosphorylation. Cyclin E's intricate dance with CDK2, CABLES1, and CCNA1 highlights its crucial role in tightly regulated cell cycle progression. Cyclin E Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived Cyclin E protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Cyclin E, an indispensable player in cell cycle regulation, takes center stage in orchestrating the G1/S transition. Teaming up with the CDK2 protein kinase, Cyclin E forms a potent serine/threonine kinase holoenzyme complex, where its cyclin subunit bestows substrate specificity upon the partnership. Notably, Cyclin E is a key constituent of a complex featuring UHRF2, CDK2, and CCNE1. Its direct interaction with UHRF2 not only ubiquitinates CCNE1 but also occurs independently of CCNE1 phosphorylation. Additionally, Cyclin E engages in a complex dance with CDK2, CABLES1, and CCNA1. The intricate interplay of Cyclin E within these complexes underscores its crucial role in the tightly regulated progression through the cell cycle.

Mouse

Sf9 insect cells

N-His;N-GST

Q61457 (M1-E408)

12447  [NCBI]

MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE

Approximately 75 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.