1. Recombinant Proteins
  2. Others
  3. Cyclin E Protein, Mouse (sf9, His-GST)

Cyclin E, a vital regulator in cell cycle control, governs the G1/S transition by forming a potent serine/threonine kinase complex with CDK2. This complex, featuring UHRF2, CDK2, and CCNE1, involves Cyclin E's direct interaction with UHRF2, leading to CCNE1 ubiquitination independently of phosphorylation. Cyclin E's intricate dance with CDK2, CABLES1, and CCNA1 highlights its crucial role in tightly regulated cell cycle progression. Cyclin E Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived Cyclin E protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclin E, a vital regulator in cell cycle control, governs the G1/S transition by forming a potent serine/threonine kinase complex with CDK2. This complex, featuring UHRF2, CDK2, and CCNE1, involves Cyclin E's direct interaction with UHRF2, leading to CCNE1 ubiquitination independently of phosphorylation. Cyclin E's intricate dance with CDK2, CABLES1, and CCNA1 highlights its crucial role in tightly regulated cell cycle progression. Cyclin E Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived Cyclin E protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

Cyclin E, an indispensable player in cell cycle regulation, takes center stage in orchestrating the G1/S transition. Teaming up with the CDK2 protein kinase, Cyclin E forms a potent serine/threonine kinase holoenzyme complex, where its cyclin subunit bestows substrate specificity upon the partnership. Notably, Cyclin E is a key constituent of a complex featuring UHRF2, CDK2, and CCNE1. Its direct interaction with UHRF2 not only ubiquitinates CCNE1 but also occurs independently of CCNE1 phosphorylation. Additionally, Cyclin E engages in a complex dance with CDK2, CABLES1, and CCNA1. The intricate interplay of Cyclin E within these complexes underscores its crucial role in the tightly regulated progression through the cell cycle.

Species

Mouse

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

Q61457 (M1-E408)

Gene ID
Molecular Construction
N-term
His-GST
Cyclin E (M1-E408)
Accession # Q61457
C-term
Synonyms
CCNE; CCNE1; CCNEcyclin Es; Cyclin E1; G1/S-specific cyclin-E1
AA Sequence

MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE

Molecular Weight

Approximately 75 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cyclin E Protein, Mouse (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclin E Protein, Mouse (sf9, His-GST)
Cat. No.:
HY-P72964
Quantity:
MCE Japan Authorized Agent: