Cystatin B/CSTB Protein, Mouse (His)

Cystatin B/CSTB Protein, an intracellular thiol proteinase inhibitor, crucially regulates proteolytic activities within the cell. By inhibiting thiol proteinases, Cystatin B maintains the balance of proteolytic processes, emphasizing its significance in cellular homeostasis. Its inhibitory function underscores involvement in cellular processes requiring precise regulation of proteolytic activity for normal cellular function and integrity. Cystatin B/CSTB Protein, Mouse (His) is the recombinant mouse-derived Cystatin B/CSTB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cystatin B/CSTB Protein, Mouse (His) is 98 a.a., with molecular weight of ~15.0 kDa.

Cystatin B/CSTB Protein functions as an intracellular thiol proteinase inhibitor. With its role in inhibiting thiol proteinases, this protein contributes to the regulation of intracellular proteolytic activities. By modulating the activity of thiol proteinases, Cystatin B plays a crucial role in maintaining the balance of proteolytic processes within the cell, highlighting its significance in cellular homeostasis. The inhibitory function of Cystatin B against thiol proteinases underscores its involvement in cellular processes where precise regulation of proteolytic activity is essential for normal cellular function and integrity.

Mouse

E. coli

N-6*His

Q62426 (M1-F98)

13014  [NCBI]

MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.