1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin-1
  5. Cystatin SN/CST1 Protein, Human (HEK293, His)

Cystatin SN/CST1 Protein, Human (HEK293, His)

Cat. No.: HY-P7867
SDS COA Handling Instructions

Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin SN/CST1 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin SN/CST1 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of ~17.0 kDa.

Background

Cystatin SN (CST1), a component of human saliva, belongs to the cysteine proteinase inhibitor family, sharing immunological similarity with cystatin S. Despite this similarity, Cystatin SN exhibits distinct specificity due to amino acid sequence variations. With a pI of 7.5, Cystatin SN stands out as a potent inhibitor of papain and dipeptidyl peptidase I, outperforming cystatin S in these inhibitory activities. Notably, both Cystatin SN and cystatin S demonstrate equal proficiency in inhibiting ficin. This highlights the intricate variations in the inhibitory capabilities within the cystatin family present in saliva, emphasizing their potential roles in regulating specific proteolytic activities.

Biological Activity

Measured in a cytotoxicity assay using A549 human non-small-cell lung carcinoma cells. The ED50 this effect is 0.4193 ng/mL, corresponding to a specific activity is 2.3849×106 units/mg.

  • Measured in a cytotoxicity assay using A549 human non-small-cell lung carcinoma cells. The ED50 this effect is 0.4193 ng/mL, corresponding to a specific activity is 2.3849×106 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

P01037 (W21-S141)

Gene ID
Molecular Construction
N-term
CST1 (W21-S141)
Accession # P01037
6*His
C-term
Synonyms
rHuCystatin-SN/CST1, His; Cystatin-SN; Cystain-SA-I; Cystatin-1; Salivary Cystatin-SA-1; CST1
AA Sequence

WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

Molecular Weight

Approximately 17.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cystatin SN/CST1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin SN/CST1 Protein, Human (HEK293, His)
Cat. No.:
HY-P7867
Quantity:
MCE Japan Authorized Agent: