1. Recombinant Proteins
  2. Others
  3. Cytoglobin/Histoglobin Protein, Human (His)

Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cytoglobin/Histoglobin Protein, Human (His) is 190 a.a., with molecular weight of ~22.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cytoglobin/Histoglobin Protein, Human (His) is 190 a.a., with molecular weight of ~22.0 kDa.

Background

The Cytoglobin/Histoglobin protein appears to play a crucial role in safeguarding cells during oxidative stress, potentially serving as a protective mechanism against cellular damage. Additionally, it is implicated in intracellular processes associated with oxygen storage or transfer. Structurally, the protein forms homodimers interconnected by disulfide linkages, highlighting its ability to foster molecular interactions and maintain stability within the cellular environment.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q8WWM9 (M1-P190)

Gene ID
Molecular Construction
N-term
CYGB (M1-P190)
Accession # Q8WWM9
6*His
C-term
Synonyms
rHuCytoglobin/Histoglobin, His; Cytoglobin; Histoglobin; HGb; Stellate Cell Activation-Associated Protein; CYGB; STAP
AA Sequence

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Molecular Weight

Approximately 22.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cytoglobin/Histoglobin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cytoglobin/Histoglobin Protein, Human (His)
Cat. No.:
HY-P70089
Quantity:
MCE Japan Authorized Agent: