Cytoglobin/Histoglobin Protein, Human (His)

Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cytoglobin/Histoglobin Protein, Human (His) is 190 a.a., with molecular weight of ~22.0 kDa.

The Cytoglobin/Histoglobin protein appears to play a crucial role in safeguarding cells during oxidative stress, potentially serving as a protective mechanism against cellular damage. Additionally, it is implicated in intracellular processes associated with oxygen storage or transfer. Structurally, the protein forms homodimers interconnected by disulfide linkages, highlighting its ability to foster molecular interactions and maintain stability within the cellular environment.

Human

E. coli

C-6*His

Q8WWM9 (M1-P190)

114757  [NCBI]

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Approximately 22.0 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.