DDOST Protein, Human

DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free. The total length of DDOST Protein, Human is 385 a.a., with molecular weight of ~44 kDa.

DDOST, a subunit of the oligosaccharyl transferase (OST) complex, plays a pivotal role in catalyzing the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This marks the crucial commencement of protein N-glycosylation, a cotranslational process. The OST complex, where DDOST is a vital component, associates with the Sec61 complex at the translocon complex, facilitating protein translocation across the endoplasmic reticulum (ER). The maximal enzyme activity of the OST complex requires the presence of all subunits. Additionally, DDOST is indispensable for the assembly of both SST3A- and SS3B-containing OST complexes. In essence, DDOST's involvement in protein modification, particularly protein glycosylation, underscores its essential role in initiating the intricate process of N-glycosylation, contributing to the structural and functional diversity of glycoproteins.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

P39656-1 (S43-P427)

1650  [NCBI]

SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP

Approximately 44 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 150 mM NaCl, pH 8.0, 8% trehalose, 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.