1. Recombinant Proteins
  2. Others
  3. CRADD Protein, Human

As an adapter protein, CRADD forms a PIDDosome complex with PIDD1 and CASP2, activates CASP2 and initiates apoptosis. It also recruits CASP2 to the TNFR-1 signaling complex in the tumor necrosis factor-mediated pathway, interacting with RIPK1 and TRADD. CRADD Protein, Human is the recombinant human-derived CRADD protein, expressed by E. coli , with tag free. The total length of CRADD Protein, Human is 199 a.a., with molecular weight of ~21.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As an adapter protein, CRADD forms a PIDDosome complex with PIDD1 and CASP2, activates CASP2 and initiates apoptosis. It also recruits CASP2 to the TNFR-1 signaling complex in the tumor necrosis factor-mediated pathway, interacting with RIPK1 and TRADD. CRADD Protein, Human is the recombinant human-derived CRADD protein, expressed by E. coli , with tag free. The total length of CRADD Protein, Human is 199 a.a., with molecular weight of ~21.0 kDa.

Background

CRADD serves as an adapter protein, forming the PIDDosome complex with PIDD1 and CASP2, which activates CASP2 and initiates apoptosis. Additionally, CRADD plays a role in the tumor necrosis factor-mediated signaling pathway by recruiting CASP2 to the TNFR-1 signaling complex through interactions with RIPK1 and TRADD. The direct interaction between CRADD and RIPK1, facilitated by their Death domains, underscores its involvement in these signaling cascades. Through its intricate associations, CRADD emerges as a key player in the regulation of apoptosis and cellular responses to TNF-mediated signals, highlighting its significance in fundamental cellular processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P78560 (M1-E199)

Gene ID
Molecular Construction
N-term
CRADD (M1-E199)
Accession # P78560
C-term
Synonyms
rHuDeath domain-containing protein CRADD/CRADD; Death Domain-Containing Protein CRADD; Caspase and RIP Adapter with Death Domain; RIP-Associated Protein with A Death Domain; CRADD; RAIDD
AA Sequence

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

Molecular Weight

Approximately 21.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CRADD Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRADD Protein, Human
Cat. No.:
HY-P70050
Quantity:
MCE Japan Authorized Agent: